| 产品详情 |
| Edit |   |
| Antigenic Specificity | MTF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Chromatin Immunoprecipitation, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC-Frozen reported in scientific literature (PMID 24529376 ). Use in chromatin immunoprecipitation reported in scientific literature (PMID 26241779). Use in IHC-P reported in scientific literature (PMID: 24529376). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MTF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MTF1. This antibody reacts with human, mouse. The MTF1 Antibody has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human MTF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCG |
| Other Names | metal regulatory transcription factor 1, metal-regulatory transcription factor 1, metal-responsive transcription factor 1, MGC23036, MRE-binding transcription factor, MRE-binding transcription factor-1, MTF-1, Transcription factor MTF-1, zinc regulatory factor, ZRF |
| Gene, Accession # | MTF1, Gene ID: 4520 |
| Catalog # | NBP1-86380 |
| Price | |
| Order / More Info | MTF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24529376, 26241779 |
| 产品资料 |
|
|