| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MTCP1NB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MTCP1NB Antibody from Novus Biologicals is a rabbit polyclonal antibody to MTCP1NB. This antibody reacts with human. The MTCP1NB Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MTCP1NB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK |
|---|
| Other Names | C6.1B, mature T-cell proliferation 1, mature T-cell proliferation 1 neighbor, mature T-cell proliferation 1 neighbor protein, Mature T-cell proliferation-1 type A, MGC2069, MTCP1, MTCP-1 type A, p8, p8MTCP1, Protein p8 MTCP-1 |
|---|
| Gene, Accession # | CMC4, Gene ID: 100272147 |
|---|
| Catalog # | NBP1-93450 |
|---|
| Price | |
|---|
| Order / More Info | MTCP1NB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|