| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MT-CO2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MT-CO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MT-CO2. This antibody reacts with human. The MT-CO2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MT-CO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEIGPVFT |
|---|
| Other Names | COII, COX2, COXII, Cytochrome C Oxidase II, Cytochrome C Oxidase Polypeptide II, Cytochrome C Oxidase Subunit II, EC 1.9.3.1, Mitochondrially Encoded Cytochrome C Oxidase II, MTCO2 |
|---|
| Gene, Accession # | MT-CO2, Gene ID: 4513, Accession: P00403, SwissProt: P00403 |
|---|
| Catalog # | NBP2-37930 |
|---|
| Price | |
|---|
| Order / More Info | MT-CO2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|