| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MST4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MST4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MST4. This antibody reacts with human. The MST4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MST4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNA |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, Mammalian STE20-like protein kinase 4, mammalian sterile 20-like 4, MASK, Mst3 and SOK1-related kinase, MST-4, serine/threonine protein kinase MASK, serine/threonine protein kinase MST4, Serine/threonine-protein kinase MASK, serine/threonine-protein kinase MST4, STE20-like kinase MST4 |
|---|
| Gene, Accession # | MST4, Gene ID: 51765, Accession: Q9P289, SwissProt: Q9P289 |
|---|
| Catalog # | NBP2-38882 |
|---|
| Price | |
|---|
| Order / More Info | MST4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|