| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LIR-8/CD85c/LILRB5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LIR-8/CD85c/LILRB5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LIR-8/CD85c/LILRB5. This antibody reacts with human. The LIR-8/CD85c/LILRB5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LIR-8/CD85c/LILRB5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG |
|---|
| Other Names | CD85 antigen-like family member C, CD85c, CD85c antigen, Leukocyte immunoglobulin-like receptor 8, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LIR8CD85C, LIR-8leukocyte immunoglobulin-like receptor subfamily B member 5, member 5 |
|---|
| Gene, Accession # | LILRB5, Gene ID: 10990 |
|---|
| Catalog # | NBP1-84575 |
|---|
| Price | |
|---|
| Order / More Info | LIR-8/CD85c/LILRB5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|