| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Liprin alpha 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Liprin alpha 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Liprin alpha 1. This antibody reacts with human. The Liprin alpha 1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Liprin alpha 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HHKALDEKVRERLRVALERCSLLEEELGATHKELMILKEQNNQKKTLTDGVLDINHEQENTPSTSGKRSSDGSLSHEEDLAKVIELQEIISKQSREQSQMKERLASLSSHVTELEEDLDTAR |
|---|
| Other Names | FLJ42630, FLJ43474, LAR-interacting protein 1, LIP.1, LIP-1, LIP1FLJ41337, LIPRIN, liprin-alpha-1, Liprin-alpha1, MGC26800, Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-1, protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 1, PTPRF-interacting protein alpha-1 |
|---|
| Gene, Accession # | PPFIA1, Gene ID: 8500 |
|---|
| Catalog # | NBP2-58915 |
|---|
| Price | |
|---|
| Order / More Info | Liprin alpha 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|