| Edit |   |
|---|
| Antigenic Specificity | lipoyltransferase 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The lipoyltransferase 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to lipoyltransferase 1. This antibody reacts with human. The lipoyltransferase 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LIPT1(lipoyltransferase 1) The peptide sequence was selected from the N terminal of LIPT1. Peptide sequence NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE. |
|---|
| Other Names | EC 2.3.1.-, Lipoyl ligase, lipoyltransferase 1, mitochondrial |
|---|
| Gene, Accession # | LIPT1, Gene ID: 51601, Accession: Q9Y234, SwissProt: Q9Y234 |
|---|
| Catalog # | NBP1-54912 |
|---|
| Price | |
|---|
| Order / More Info | lipoyltransferase 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|