| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCDC114 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, IP, WB reactivity reported in (PMID: 25192045). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC114 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC114. This antibody reacts with human, mouse. The CCDC114 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human CCDC114 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKDDQHLLQEQQQKVLQQRMDKVHSEAERLEARFQDVRGQLEKLKADIQLLFTKAHCDSSMIDDLLGVKTSMGDRDMGLFLSLIEKRLVE |
|---|
| Other Names | coiled-coil domain containing 114, FLJ32926 |
|---|
| Gene, Accession # | CCDC114, Gene ID: 93233 |
|---|
| Catalog # | NBP1-93863 |
|---|
| Price | |
|---|
| Order / More Info | CCDC114 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23261303, 25192045 |
|---|
| 产品资料 |
|
|