| Edit |   |
|---|
| Antigenic Specificity | CCDC11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC11. This antibody reacts with human. The CCDC11 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC11(coiled-coil domain containing 11) The peptide sequence was selected from the N terminal of CCDC11. Peptide sequence YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL. |
|---|
| Other Names | coiled-coil domain containing 11, coiled-coil domain-containing protein 11, FLJ32743 |
|---|
| Gene, Accession # | CCDC11, Gene ID: 220136, Accession: Q96M91, SwissProt: Q96M91 |
|---|
| Catalog # | NBP1-56790 |
|---|
| Price | |
|---|
| Order / More Info | CCDC11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|