| Edit |   |
| Antigenic Specificity | CCDC108 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC108 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC108. This antibody reacts with human. The CCDC108 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CCDC108 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TVDVPIHILGWNSALIHFQGVGYNPHMMGDTAPFHNISSWDNSSIHSRLVVPGQNVFLSQSHISLGNIPVQSKCSRLLFLNNISKNEEIAFSWQPS |
| Other Names | coiled-coil domain containing 108 |
| Gene, Accession # | CCDC108, Gene ID: 255101, Accession: Q6ZU64, SwissProt: Q6ZU64 |
| Catalog # | NBP2-30989 |
| Price | |
| Order / More Info | CCDC108 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |