| Edit |   |
| Antigenic Specificity | CCDC106 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC106 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC106. This antibody reacts with human. The CCDC106 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CCDC106 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQ |
| Other Names | coiled-coil domain containing 106, coiled-coil domain-containing protein 106, HSU79303, protein predicted by clone 23882, ZNF581 |
| Gene, Accession # | CCDC106, Gene ID: 29903, Accession: Q9BWC9, SwissProt: Q9BWC9 |
| Catalog # | NBP2-30542 |
| Price | |
| Order / More Info | CCDC106 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |