| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | C2CD4C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C2CD4C Antibody from Novus Biologicals is a rabbit polyclonal antibody to C2CD4C. This antibody reacts with human. The C2CD4C Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C2CD4C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWLSEEATDADPQAQGAMSLPSVPKAQTSYGFAMLAES |
|---|
| Other Names | C2 Calcium-Dependent Domain Containing 4C, C2 Calcium-Dependent Domain-Containing Protein 4C, FAM148C, Family With Sequence Similarity 148, Member C, KIAA1957, NLF3, Nuclear Localized Factor 3, Nuclear-Localized Factor 3, Protein FAM148C |
|---|
| Gene, Accession # | C2CD4C, Gene ID: 126567, Accession: Q8TF44, SwissProt: Q8TF44 |
|---|
| Catalog # | NBP2-30575 |
|---|
| Price | |
|---|
| Order / More Info | C2CD4C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|