| Edit |   |
|---|
| Antigenic Specificity | CC2D1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CC2D1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to CC2D1B. This antibody reacts with human. The CC2D1B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CC2D1B(coiled-coil and C2 domain containing 1B) The peptide sequence was selected from the C terminal of CC2D1B. Peptide sequence IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF. |
|---|
| Other Names | coiled-coil and C2 domain containing 1B, KIAA1836coiled-coil and C2 domain-containing protein 1B |
|---|
| Gene, Accession # | CC2D1B, Gene ID: 200014, Accession: Q5T0F9, SwissProt: Q5T0F9 |
|---|
| Catalog # | NBP1-52841-20ul |
|---|
| Price | |
|---|
| Order / More Info | CC2D1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|