| Edit |   |
| Antigenic Specificity | C2CD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C2CD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C2CD2. This antibody reacts with human. The C2CD2 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C2CD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAAASAPPEEAESAQASLAPKPQEDELDSWDLEKEP |
| Other Names | C2 calcium-dependent domain containing 2 |
| Gene, Accession # | C2CD2, Gene ID: 25966, Accession: Q9Y426, SwissProt: Q9Y426 |
| Catalog # | NBP2-33941 |
| Price | |
| Order / More Info | C2CD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |