| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATG9A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATG9A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATG9A. This antibody reacts with human. The ATG9A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ATG9A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD |
|---|
| Other Names | APG9 autophagy 9-like 1, APG9 autophagy 9-like 1 (S. cerevisiae), APG9L1APG9-like 1, ATG9 autophagy related 9 homolog A (S. cerevisiae), autophagy 9-like 1 protein, autophagy-related protein 9A, FLJ22169, mATG9, MGD3208 |
|---|
| Gene, Accession # | ATG9A, Gene ID: 79065 |
|---|
| Catalog # | NBP2-32477 |
|---|
| Price | |
|---|
| Order / More Info | ATG9A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|