| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATG4A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATG4A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATG4A. This antibody reacts with human. The ATG4A Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ATG4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTG |
|---|
| Other Names | APG4 autophagy 4 homolog A (S. cerevisiae), APG4A, ATG4 autophagy related 4 homolog A (S. cerevisiae), AUTL2, AUT-like 2 cysteine endopeptidase, AUT-like 2, cysteine endopeptidase (S. cerevisiae), autophagin 2, autophagin-2, cysteine endopeptidase, cysteine protease ATG4A, EC 3.4.22, EC 3.4.22.-, hAPG4A |
|---|
| Gene, Accession # | ATG4A, Gene ID: 115201 |
|---|
| Catalog # | NBP2-56465 |
|---|
| Price | |
|---|
| Order / More Info | ATG4A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|