| Edit |   |
|---|
| Antigenic Specificity | ATG2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATG2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATG2A. This antibody reacts with human. The ATG2A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ATG2A(ATG2 autophagy related 2 homolog A (S. cerevisiae)) Antibody(against the N terminal of ATG2A. Peptide sequence PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMF. |
|---|
| Other Names | ATG2 autophagy related 2 homolog A (S. cerevisiae), autophagy-related protein 2 homolog A, KIAA0404MGC117153 |
|---|
| Gene, Accession # | ATG2A, Gene ID: 23130, Accession: Q2TAZ0, SwissProt: Q2TAZ0 |
|---|
| Catalog # | NBP1-57631 |
|---|
| Price | |
|---|
| Order / More Info | ATG2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|