| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cbx2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cbx2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cbx2. This antibody reacts with human. The Cbx2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cbx2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV |
|---|
| Other Names | CDCA6, cell division cycle associated 6, chromobox homolog 2, chromobox homolog 2 (Drosophila Pc class), chromobox homolog 2 (Pc class homolog, Drosophila), chromobox protein homolog 2, M33, MGC10561, modifier 3, Pc class homolog |
|---|
| Gene, Accession # | CBX2, Gene ID: 84733 |
|---|
| Catalog # | NBP2-47524 |
|---|
| Price | |
|---|
| Order / More Info | Cbx2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|