| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PER3 |
|---|
| Clone | 3A7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PER3 Antibody (3A7) from Novus Biologicals is a mouse monoclonal antibody to PER3. This antibody reacts with human. The PER3 Antibody (3A7) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation. |
|---|
| Immunogen | PER3 (NP_058515.1 1105 a.a. - 1201 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC |
|---|
| Other Names | Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila) |
|---|
| Gene, Accession # | PER3, Gene ID: 8863, Accession: NP_058515, SwissProt: NP_058515 |
|---|
| Catalog # | H00008863-M01 |
|---|
| Price | |
|---|
| Order / More Info | PER3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|