| Edit |   |
|---|
| Antigenic Specificity | Peptide YY |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Peptide YY Antibody from Novus Biologicals is a rabbit polyclonal antibody to Peptide YY. This antibody reacts with human. The Peptide YY Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PYY(peptide YY) The peptide sequence was selected from the middle region of PYY. Peptide sequence APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED. |
|---|
| Other Names | Peptide tyrosine tyrosine, peptide YY, PYY1, PYY-I |
|---|
| Gene, Accession # | PYY, Gene ID: 5697, Accession: P10082, SwissProt: P10082 |
|---|
| Catalog # | NBP1-59345 |
|---|
| Price | |
|---|
| Order / More Info | Peptide YY Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|