| Edit |   |
|---|
| Antigenic Specificity | Peptidylglycine alpha-Amidating Monooxygenase/PAM |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody from Novus Biologicals is a rabbit polyclonal antibody to Peptidylglycine alpha-Amidating Monooxygenase/PAM. This antibody reacts with human. The Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PAM(peptidylglycine alpha-amidating monooxygenase) The peptide sequence was selected from the N terminal of PAM. Peptide sequence PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL. |
|---|
| Other Names | PAL, pancreatic peptidylglycine alpha-amidating monooxygenase, peptidyl alpha-amidating enzyme, peptidyl-alpha-hydroxyglycine alpha-amidating lyase, peptidylamidoglycolate lyase, peptidylglycine 2-hydroxylase, peptidyl-glycine alpha-amidating monooxygenase, peptidylglycine alpha-amidating monooxygenase, peptidylglycine alpha-hydroxylating monooxygenase, PHM |
|---|
| Gene, Accession # | PAM, Gene ID: 5066, Accession: A6NMR0, SwissProt: A6NMR0 |
|---|
| Catalog # | NBP1-69318 |
|---|
| Price | |
|---|
| Order / More Info | Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|