| 产品详情 |
| Edit |   |
| Antigenic Specificity | Coagulation Factor II/Thrombin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Coagulation Factor II/Thrombin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Coagulation Factor II/Thrombin. This antibody reacts with human. The Coagulation Factor II/Thrombin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human F2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLE |
| Other Names | Coagulation Factor II, coagulation factor II (thrombin) receptor-like 2, Coagulation factor II receptor-like 2, Coagulation factor II receptor-like 2 (protease-actovated receptor 3), PAR-3, PAR3proteinase-activated receptor 3, protease-activated receptor 3, proteinase-activated receptor-3, PT, serine protease, Thrombin receptor-like 2 |
| Gene, Accession # | F2, Gene ID: 2147, Accession: P00734, SwissProt: P00734 |
| Catalog # | NBP2-33728 |
| Price | |
| Order / More Info | Coagulation Factor II/Thrombin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|