| 产品详情 |
| Edit |   |
| Antigenic Specificity | Coagulation Factor III/Tissue Factor |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Coagulation Factor III/Tissue Factor Antibody from Novus Biologicals is a rabbit polyclonal antibody to Coagulation Factor III/Tissue Factor. This antibody reacts with human. The Coagulation Factor III/Tissue Factor Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Coagulation Factor III/Tissue Factor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN |
| Other Names | CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor |
| Gene, Accession # | F3, Gene ID: 2152 |
| Catalog # | NBP2-58054 |
| Price | |
| Order / More Info | Coagulation Factor III/Tissue Factor Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|