| Edit |   |
|---|
| Antigenic Specificity | Coactosin-like Protein 1/CotL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Coactosin-like Protein 1/CotL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Coactosin-like Protein 1/CotL1. This antibody reacts with human. The Coactosin-like Protein 1/CotL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to COTL1(coactosin-like 1 (Dictyostelium)) The peptide sequence was selected from the N terminal of COTL1. Peptide sequence MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ. |
|---|
| Other Names | CLPFLJ43657, coactosin-like 1 (Dictyostelium), coactosin-like protein, MGC19733 |
|---|
| Gene, Accession # | COTL1, Gene ID: 23406, Accession: Q14019, SwissProt: Q14019 |
|---|
| Catalog # | NBP1-54851-20ul |
|---|
| Price | |
|---|
| Order / More Info | Coactosin-like Protein 1/CotL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|