| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HSP40/DNAJB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HSP40/DNAJB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSP40/DNAJB1. This antibody reacts with human. The HSP40/DNAJB1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HSP40/DNAJB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL |
|---|
| Other Names | DnaJ (Hsp40) homolog, subfamily B, member 1, DnaJ (Hsp40) homolog, subfmaily B, member 1, dnaJ homolog subfamily B member 1, DnaJ protein homolog 1, DNAJ1, hDj-1, HDJ1, Heat shock 40 kDa protein 1, heat shock 40kD protein 1, Heat shock protein 40, HSP40, HSPF1Hdj1, Human DnaJ protein 1, radial spoke 16 homolog B, RSPH16B, Sis1 |
|---|
| Gene, Accession # | DNAJB1, Gene ID: 3337, Accession: P25685, SwissProt: P25685 |
|---|
| Catalog # | NBP2-38988 |
|---|
| Price | |
|---|
| Order / More Info | HSP40/DNAJB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|