| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SRA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRA1. This antibody reacts with human. The SRA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SRA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGP |
|---|
| Other Names | MGC87674, pp7684, SRA, SRAP, steriod receptor RNA activator 1, steriod receptor RNA activator protein, steroid receptor coactivator, steroid receptor RNA activator 1, steroid receptor RNA activator 1 (complexes with NCOA1), Steroid receptor RNA activator protein, STRAA1 |
|---|
| Gene, Accession # | SRA1, Gene ID: 10011 |
|---|
| Catalog # | NBP2-48816 |
|---|
| Price | |
|---|
| Order / More Info | SRA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|