| Edit |   |
|---|
| Antigenic Specificity | SQRDL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SQRDL Antibody from Novus Biologicals is a rabbit polyclonal antibody to SQRDL. This antibody reacts with mouse. The SQRDL Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Sqrdl - C-terminal region. Peptide sequence AQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPL. |
|---|
| Other Names | CGI-44, sulfide dehydrogenase like, sulfide quinone reductase-like (yeast), sulfide:quinone oxidoreductase, mitochondrial |
|---|
| Gene, Accession # | SQRDL, Gene ID: 58472, Accession: NP_067482 |
|---|
| Catalog # | NBP1-98431 |
|---|
| Price | |
|---|
| Order / More Info | SQRDL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|