| 产品详情 |
| Edit |   |
| Antigenic Specificity | SPTLC3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | 0.1 mg/ml |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPTLC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPTLC3. This antibody reacts with human. The SPTLC3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human SPTLC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA |
| Other Names | C20orf38, Chromosome 20 Open Reading Frame 38, dJ718P11, EC 2.3.1.50, hLCB2b, LCB 3, LCB2B, LCB3, Long Chain Base Biosynthesis Protein 2b, Long Chain Base Biosynthesis Protein 3, Serine Palmitoyltransferase 3, Serine Palmitoyltransferase, Long Chain Base Subunit 2-Like (Aminotransferase 2), Serine Palmitoyltransferase, Long Chain Base Subunit 3, Serine-Palmitoyl-CoA Transferase 3, SPT 3, SPT3, SPTLC2L |
| Gene, Accession # | SPTLC3, Gene ID: 55304 |
| Catalog # | NBP2-54899 |
| Price | |
| Order / More Info | SPTLC3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|