| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MEKK1 |
|---|
| Clone | 2F6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A/G purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1.0 mg/ml |
|---|
| Applications | Western Blot, Flow Cytometry, Immunohistochemistry-Paraffin, Immunofluorescence, CyTOF-ready. Hu-chromosome location: 5q11.2 Molecular weight of antigen: 195kDa (intact); 80kDa (cleaved) Immunohistochemistry-Paraffin 0.5 - 1 ug/ml for 30 minutes at RT; Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 10 - 20 min followed by cooling at RT for 20 minutes. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MEKK1 Antibody (2F6) - Azide and BSA Free from Novus Biologicals is a mouse monoclonal antibody to MEKK1. This antibody reacts with human. The MEKK1 Antibody (2F6) - Azide and BSA Free has been validated for the following applications: Western Blot, Flow Cytometry, Immunohistochemistry-Paraffin, Immunofluorescence, CyTOF-ready. Specificity: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors |
|---|
| Immunogen | Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) |
|---|
| Other Names | MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1 |
|---|
| Gene, Accession # | MAP3K1, Gene ID: 4214 |
|---|
| Catalog # | NBP2-47810-0.1mg |
|---|
| Price | |
|---|
| Order / More Info | MEKK1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|