| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MEK5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MEK5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MEK5. This antibody reacts with human. The MEK5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MEK5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNG |
|---|
| Other Names | HsT17454, MAP kinase kinase 5, MAP kinase kinase MEK5b, MAPK/ERK kinase 5, MAPKK 5, MAPKK5EC 2.7.12.2, MEK5MEK 5, mitogen-activated protein kinase kinase 5, MKK5, PRKMK5dual specificity mitogen-activated protein kinase kinase 5 |
|---|
| Gene, Accession # | MAP2K5, Gene ID: 5607 |
|---|
| Catalog # | NBP1-89654 |
|---|
| Price | |
|---|
| Order / More Info | MEK5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|