| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDT2. This antibody reacts with human. The CDT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CDT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTSPVAIF |
|---|
| Other Names | CDT2RA-regulated nuclear matrix-associated protein, CDW1, DCAF2DDB1 and CUL4 associated factor 2, DDB1- and CUL4-associated factor 2, denticleless homolog (Drosophila), L2DTLRA regulated nuclear matrix associated protein, Lethal(2) denticleless protein homolog, RAMPdenticleless protein homolog, Retinoic acid-regulated nuclear matrix-associated protein |
|---|
| Gene, Accession # | DTL, Gene ID: 51514 |
|---|
| Catalog # | NBP1-85283 |
|---|
| Price | |
|---|
| Order / More Info | CDT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21752725 |
|---|
| 产品资料 |
|
|