| 产品详情 |
| Edit |   |
| Antigenic Specificity | CD77 Synthase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CD77 Synthase Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD77 Synthase. This antibody reacts with human. The CD77 Synthase Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT (NP_059132). Peptide sequence RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAF |
| Other Names | A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group), A4GALT1, alpha 1,4-galactosyltransferase, Alpha-1,4-galactosyltransferase, Alpha-1,4-N-acetylglucosaminyltransferase, alpha4Gal-T1, CD77 synthase, EC 2.4.1.228, Gb3 synthase, Gb3S, Globotriaosylceramide synthase, lactosylceramide 4-alpha-galactosyltransferase, P blood group (P one antigen), P(k), P(k) antigen synthase, P1, P1/Pk synthase, PK, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase |
| Gene, Accession # | A4GALT, Gene ID: 53947, Accession: Q9NPC4, SwissProt: Q9NPC4 |
| Catalog # | NBP1-62583-20ul |
| Price | |
| Order / More Info | CD77 Synthase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 18067504 |
| 产品资料 |
|
|