| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD77 Synthase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD77 Synthase Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD77 Synthase. This antibody reacts with human. The CD77 Synthase Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CD77 Synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD',) |
|---|
| Other Names | A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group), A4GALT1, alpha 1,4-galactosyltransferase, Alpha-1,4-galactosyltransferase, Alpha-1,4-N-acetylglucosaminyltransferase, alpha4Gal-T1, CD77 synthase, EC 2.4.1.228, Gb3 synthase, Gb3S, Globotriaosylceramide synthase, lactosylceramide 4-alpha-galactosyltransferase, P blood group (P one antigen), P(k), P(k) antigen synthase, P1, P1/Pk synthase, PK, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase |
|---|
| Gene, Accession # | A4GALT, Gene ID: 53947 |
|---|
| Catalog # | NBP2-57614 |
|---|
| Price | |
|---|
| Order / More Info | CD77 Synthase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|