| Edit |   |
|---|
| Antigenic Specificity | B-Myb |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B-Myb Antibody from Novus Biologicals is a rabbit polyclonal antibody to B-Myb. This antibody reacts with human. The B-Myb Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human B-Myb antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LQASHQQQVLPPRQPSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVALSPVTENSTSLSFLDSCNSLTPKSTPVKTLPF |
|---|
| Other Names | B-MYB, BMYBMGC15600, Myb-like protein 2, myb-related protein B, v-myb avian myeloblastosis viral oncogene homolog-like 2, v-myb myeloblastosis viral oncogene homolog (avian)-like 2 |
|---|
| Gene, Accession # | MYBL2, Gene ID: 4605 |
|---|
| Catalog # | NBP2-56847 |
|---|
| Price | |
|---|
| Order / More Info | B-Myb Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|