| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FKBP12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FKBP12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FKBP12. This antibody reacts with human. The FKBP12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FKBP12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD |
|---|
| Other Names | 12 kDa FKBP, EC 5.2.1.8, FK506 binding protein 1A, 12kDa, FK506-binding protein 1A, FKBP1, FKBP12C, FKBP12FKBP12-Exip3, FKBP-12T-cell, 12-kD, FKBP-1A, peptidyl-prolyl cis-trans isomerase FKBP1A, PPIase FKBP1A, protein kinase C inhibitor 2, rotamase |
|---|
| Gene, Accession # | FKBP1A, Gene ID: 2280 |
|---|
| Catalog # | NBP2-14017 |
|---|
| Price | |
|---|
| Order / More Info | FKBP12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|