| 产品详情 |
| Edit |   |
| Antigenic Specificity | FKBP10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FKBP10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FKBP10. This antibody reacts with human. The FKBP10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FKBP10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVP PHLAHGESGARGVPGSAVLLFEVELVSRED |
| Other Names | 65 kDa FK506-binding protein, 65 kDa FKBP, EC 5.2.1.8, FK506 binding protein 10 (65 kDa), FK506 binding protein 10, 65 kDa, FK506-binding protein 10, FKBP-10, FKBP6, FKBP-65, FKBP65PPIase FKBP10, FLJ20683, FLJ22041, FLJ23833, hFKBP65, Immunophilin FKBP65, OI6, peptidyl-prolyl cis-trans isomerase FKBP10, PPIASE, Rotamase |
| Gene, Accession # | FKBP10, Gene ID: 60681 |
| Catalog # | NBP2-14016 |
| Price | |
| Order / More Info | FKBP10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|