| Edit |   |
| Antigenic Specificity | OSGIN2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The OSGIN2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OSGIN2. This antibody reacts with human. The OSGIN2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to OSGIN2 (oxidative stress induced growth inhibitor family member 2) The peptide sequence was selected from the C terminal of OSGIN2. Peptide sequence ECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGG. |
| Other Names | hT41C8orf1chromosome 8 open reading frame 1, oxidative stress induced growth inhibitor family member 2, oxidative stress-induced growth inhibitor 2 |
| Gene, Accession # | OSGIN2, Gene ID: 734, Accession: Q9Y236, SwissProt: Q9Y236 |
| Catalog # | NBP1-68933 |
| Price | |
| Order / More Info | OSGIN2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |