| Edit |   |
| Antigenic Specificity | STRA8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The STRA8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STRA8. This antibody reacts with human. The STRA8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED. |
| Other Names | stimulated by retinoic acid gene 8 homolog (mouse), stimulated by retinoic acid gene 8 protein homolog |
| Gene, Accession # | STRA8, Gene ID: 346673, Accession: Q7Z7C7, SwissProt: Q7Z7C7 |
| Catalog # | NBP1-98492 |
| Price | |
| Order / More Info | STRA8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |