| Edit |   |
| Antigenic Specificity | STRA6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The STRA6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STRA6. This antibody reacts with human. The STRA6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to STRA6(stimulated by retinoic acid gene 6 homolog (mouse)) The peptide sequence was selected from the N terminal of STRA6 (NP_071764). Peptide sequence MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG. |
| Other Names | FLJ12541, MCOPS9, stimulated by retinoic acid gene 6 homolog (mouse), stimulated by retinoic acid gene 6 protein homolog |
| Gene, Accession # | STRA6, Gene ID: 64220, Accession: Q9BX79, SwissProt: Q9BX79 |
| Catalog # | NBP1-59711 |
| Price | |
| Order / More Info | STRA6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 18316031 |