| Edit |   |
|---|
| Antigenic Specificity | RAG2 |
|---|
| Clone | 2G8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAG2 Antibody (2G8) from Novus Biologicals is a mouse monoclonal antibody to RAG2. This antibody reacts with human, rat. The RAG2 Antibody (2G8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | RAG2 (NP_000527.1 428 a.a. - 527 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD |
|---|
| Other Names | RAG-2, recombination activating gene 2, V(D)J recombination-activating protein 2 |
|---|
| Gene, Accession # | RAG2, Gene ID: 5897, Accession: NP_000527, SwissProt: NP_000527 |
|---|
| Catalog # | H00005897-M06 |
|---|
| Price | |
|---|
| Order / More Info | RAG2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|