| Edit |   |
| Antigenic Specificity | RAG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Chromatin Immunoprecipitation |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RAG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAG1. This antibody reacts with mouse. The RAG1 Antibody has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation. |
| Immunogen | Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT. |
| Other Names | MGC43321, RAG-1, recombination activating gene 1, RING finger protein 74, RNF74recombination activating protein 1, V(D)J recombination-activating protein 1 |
| Gene, Accession # | RAG1, Gene ID: 5896, Accession: P15919 |
| Catalog # | NBP1-74190-20ul |
| Price | |
| Order / More Info | RAG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23169648, 24614102 |