| Edit |   |
|---|
| Antigenic Specificity | Deleted in azoospermia 4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Deleted in azoospermia 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Deleted in azoospermia 4. This antibody reacts with human. The Deleted in azoospermia 4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DAZ4(deleted in azoospermia 4) The peptide sequence was selected from the middle region of DAZ4. Peptide sequence ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA. |
|---|
| Other Names | deleted in azoospermia 4, deleted in azoospermia protein 4, pDP1680, pDP1681 |
|---|
| Gene, Accession # | DAZ4, Gene ID: 57135, Accession: Q86SG3-2, SwissProt: Q86SG3-2 |
|---|
| Catalog # | NBP1-57480-20ul |
|---|
| Price | |
|---|
| Order / More Info | Deleted in azoospermia 4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|