| Edit |   |
| Antigenic Specificity | KCTD4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCTD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCTD4. This antibody reacts with human. The KCTD4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human KCTD4. Peptide sequence RSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFI. |
| Other Names | bA321C24.3, BTB/POZ domain-containing protein KCTD4, potassium channel tetramerisation domain containing 4 |
| Gene, Accession # | KCTD4, Gene ID: 386618, Accession: NP_940686, SwissProt: NP_940686 |
| Catalog # | NBP1-80208-20ul |
| Price | |
| Order / More Info | KCTD4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |