| Edit |   |
| Antigenic Specificity | KCTD21 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCTD21 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCTD21. This antibody reacts with human. The KCTD21 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human KCTD21The immunogen for this antibody is KCTD21. Peptide sequence RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE. |
| Other Names | BTB/POZ domain-containing protein KCTD21, KCASH2, potassium channel tetramerisation domain containing 21 |
| Gene, Accession # | KCTD21, Gene ID: 283219, Accession: NP_001025030, SwissProt: NP_001025030 |
| Catalog # | NBP1-79548 |
| Price | |
| Order / More Info | KCTD21 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |