| Edit |   |
|---|
| Antigenic Specificity | KCTD21 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCTD21 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCTD21. This antibody reacts with human. The KCTD21 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human KCTD21The immunogen for this antibody is KCTD21. Peptide sequence RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE. |
|---|
| Other Names | BTB/POZ domain-containing protein KCTD21, KCASH2, potassium channel tetramerisation domain containing 21 |
|---|
| Gene, Accession # | KCTD21, Gene ID: 283219, Accession: NP_001025030, SwissProt: NP_001025030 |
|---|
| Catalog # | NBP1-79548-20ul |
|---|
| Price | |
|---|
| Order / More Info | KCTD21 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|