| Edit |   |
| Antigenic Specificity | KCTD16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCTD16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCTD16. This antibody reacts with human. The KCTD16 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KCTD16 (potassium channel tetramerisation domain containing 16) The peptide sequence was selected from the N terminal of KCTD16. Peptide sequence KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL. |
| Other Names | BTB/POZ domain-containing protein KCTD16, DKFZp781A1155, KIAA1317Potassium channel tetramerization domain-containing protein 16, MGC138167, potassium channel tetramerisation domain containing 16 |
| Gene, Accession # | KCTD16, Gene ID: 57528, Accession: Q68DU8, SwissProt: Q68DU8 |
| Catalog # | NBP1-57708 |
| Price | |
| Order / More Info | KCTD16 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |