| 产品详情 |
| Edit |   |
| Antigenic Specificity | Ataxin-10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ataxin-10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ataxin-10. This antibody reacts with human. The Ataxin-10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Ataxin-10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDE PLTKDDIPVFLRHAELIASTF |
| Other Names | ataxin 10, ataxin-10, Brain protein E46 homolog, E46L, FLJ37990, HUMEEP, SCA10spinocerebellar ataxia 10, Spinocerebellar ataxia type 10 protein |
| Gene, Accession # | ATXN10, Gene ID: 25814 |
| Catalog # | NBP2-14336 |
| Price | |
| Order / More Info | Ataxin-10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|