| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATAT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATAT1. This antibody reacts with human. The ATAT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ATAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QQIMTIIDELGKASAKAQNLSAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDR |
| Other Names | Acetyltransferase MEC-17, alpha tubulin acetyltransferase 1, alpha-TAT, alpha-tubulin N-acetyltransferase, C6orf134, chromosome 6 open reading frame 134, DKFZp547J097, EC 2.3.1.108, Em:AB023049.7, FLJ13158, MEC17Nbla00487, TAT |
| Gene, Accession # | ATAT1, Gene ID: 79969 |
| Catalog # | NBP2-48990 |
| Price | |
| Order / More Info | ATAT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|