| 产品详情 |
| Edit |   |
| Antigenic Specificity | alpha-1A Adrenergic R/ADRA1A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The alpha-1A Adrenergic R/ADRA1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to alpha-1A Adrenergic R/ADRA1A. This antibody reacts with human. The alpha-1A Adrenergic R/ADRA1A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human alpha-1A Adrenergic R/ADRA1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGE |
| Other Names | ADRA1Cadrenergic, alpha-1A-, receptor variant 1, ADRA1L1, adrenergic, alpha -1A-, receptor, adrenergic, alpha-1A-, receptor, adrenergic, alpha-1A-, receptor variant 3, adrenergic, alpha-1A-, receptor variant 5, adrenergic, alpha-1A-, receptor variant 8, adrenergic, alpha-1C-, receptor, alpha-1A adrenergic receptor, Alpha-1A adrenoceptor, Alpha-1A adrenoreceptor, ALPHA1AAR, Alpha-1C adrenergic receptor, Alpha-adrenergic receptor 1c, G protein coupled receptor |
| Gene, Accession # | ADRA1A, Gene ID: 148, Accession: P35348, SwissProt: P35348 |
| Catalog # | NBP2-38145 |
| Price | |
| Order / More Info | alpha-1A Adrenergic R/ADRA1A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|