| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CRIF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CRIF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CRIF1. This antibody reacts with human. The CRIF1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CRIF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER |
|---|
| Other Names | CKBBP2, CKII beta-associating protein, CR6 interacting factor 1, CRIF1p53-responsive gene 6 protein, growth arrest and DNA damage-inducible proteins-interacting protein 1, growth arrest and DNA-damage-inducible, gamma interacting protein 1, MGC4667, MGC4758, papillomavirus L2 interacting nuclear protein 1, Papillomavirus L2-interacting nuclear protein 1, Plinp1, PLINP-1CKII beta binding protein 2, PRG6CR6-interacting factor 1 |
|---|
| Gene, Accession # | GADD45GIP1, Gene ID: 90480, Accession: Q8TAE8, SwissProt: Q8TAE8 |
|---|
| Catalog # | NBP2-39045 |
|---|
| Price | |
|---|
| Order / More Info | CRIF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|